CYP2C18 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CYP2C18 expression in transfected 293T cell line (H00001562-T01) by CYP2C18 MaxPab polyclonal antibody.
Lane1:CYP2C18 transfected lysate(53.9 KDa).
Lane2:Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CYP2C18 protein.
Immunogen
CYP2C18 (NP_000763.1, 1 a.a. ~ 490 a.a) full-length human protein.
Sequence
MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYIKSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTETTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYIDLLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFKKSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (79)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CYP2C18 expression in transfected 293T cell line (H00001562-T01) by CYP2C18 MaxPab polyclonal antibody.
Lane1:CYP2C18 transfected lysate(53.9 KDa).
Lane2:Non-transfected lysate.
-
Gene Info — CYP2C18
Entrez GeneID
1562GeneBank Accession#
NM_000772.1Protein Accession#
NP_000763.1Gene Name
CYP2C18
Gene Alias
CPCI, CYP2C, CYP2C17, DKFZp686I24235, P450-6B/29C, P450IIC17
Gene Description
cytochrome P450, family 2, subfamily C, polypeptide 18
Omim ID
601131Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum but its specific substrate has not yet been determined. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. An additional gene, CYP2C17, was once thought to exist; however, CYP2C17 is now considered an artefact based on a chimera of CYP2C18 and CYP2C19. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
(S)-mephenytoin hydroxylase associated cytochrome P450|OTTHUMP00000020131|cytochrome P450 family 2 subfamily C polypeptide 18|cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 17|cytochrome P450, subfamily IIC (mephenytoin 4-hydroxyl
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com