CSTF3 monoclonal antibody (M01), clone 1D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CSTF3.
Immunogen
CSTF3 (AAH09792, 1 a.a. ~ 103 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CSTF3 expression in transfected 293T cell line by CSTF3 monoclonal antibody (M01), clone 1D4.
Lane 1: CSTF3 transfected lysate(11.44 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CSTF3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CSTF3 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CSTF3 over-expressed 293 cell line, cotransfected with CSTF3 Validated Chimera RNAi ( Cat # H00001479-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CSTF3 monoclonal antibody (M01), clone 1D4 (Cat # H00001479-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to CSTF3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CSTF3
Entrez GeneID
1479GeneBank Accession#
BC009792Protein Accession#
AAH09792Gene Name
CSTF3
Gene Alias
CSTF-77, MGC117398, MGC43001, MGC75122
Gene Description
cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
Omim ID
600367Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The encoded protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
CSTF 77 kDa subunit|cleavage stimulation factor subunit 3|cleavage stimulation factor subunit 3, isoform 1
-
Interactome
-
Publication Reference
-
Polyadenylation site-specific differences in the activity of the neuronal βCstF-64 protein in PC-12 cells.
Shankarling GS, Macdonald CC.
Gene 2013 Oct; 529(2):220.
Application:WB-Tr, Rat, PC-12 cells.
-
Polyadenylation site-specific differences in the activity of the neuronal βCstF-64 protein in PC-12 cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com