CSE1L monoclonal antibody (M08), clone 3D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CSE1L.
Immunogen
CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (92)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CSE1L monoclonal antibody (M08), clone 3D8 Western Blot analysis of CSE1L expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CSE1L is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CSE1L
Entrez GeneID
1434GeneBank Accession#
NM_001316Protein Accession#
NP_001307Gene Name
CSE1L
Gene Alias
CAS, CSE1, MGC117283, MGC130036, MGC130037, XPO2
Gene Description
CSE1 chromosome segregation 1-like (yeast)
Omim ID
601342Gene Ontology
HyperlinkGene Summary
Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. [provided by RefSeq
Other Designations
CSE1 chromosome segregation 1-like protein|OTTHUMP00000043373|cellular apoptosis susceptibility protein|chromosome segregation 1-like|importin-alpha re-exporter
-
Interactome
-
Publication Reference
-
Oncogenic Ras expression increases cytoplasmic distribution and phosphorylation of CSE1L in B16F10 melanoma cells.
Wu PR, Yeh CM, Chang CC, Huang HY, Wang KC, Shih HJ, Lee IY, Jiang MC, Lin YM.
International Journal of Clinical and Experimental Pathology 2016 Oct; 9(10):9889.
Application:IF, WB, Mouse, B16F10 melanoma cells.
-
CSE1L Links cAMP/PKA and Ras/ERK pathways and regulates the expressions and phosphorylations of ERK1/2, CREB, and MITF in melanoma cells.
Lee WR, Shen SC, Wu PR, Chou CL, Shih YH, Yeh CM, Yeh KT, Jiang MC.
Molecular Carcinogenesis 2016 Nov; 55(11):1542.
Application:IHC,WB, Human, Mouse, B16F10 mouse melanoma cells, A375 human melanoma cells.
-
hCAS/CSE1L regulates RAD51 distribution and focus formation for homologous recombinational repair.
Okimoto S, Sun J, Fukuto A, Horikoshi Y, Matsuda S, Matsuda T, Ikura M, Ikura T, Machida S, Kurumizaka H, Miyamoto Y, Oka M, Yoneda Y, Kiuchi Y, Tashiro S.
Genes to Cells 2015 Sep; 20(9):681.
Application:WB, WB-Tr, Human, HeLa, U2OS cells.
-
Early decline in serum phospho-CSE1L levels in vemurafenib/sunitinib-treated melanoma and sorafenib/lapatinib-treated colorectal tumor xenografts.
Lee WR, Shen SC, Shih YH, Chou CL, Tseng JT, Chin SY, Liu KH, Chen YC, Jiang MC.
Journal of Translational Medicine 2015 Jun; 13:191.
Application:WB-Ce, Human, B16-dEV, B16-CSE1L, B16-Ras cells.
-
High expression of cytoplasmic phosphorylated CSE1L in malignant melanoma but not in benign nevi: phosphorylated CSE1L for the discrimination between melanoma and benign nevi.
Chin SY, Wu PR, Shih YH, Yeh CM, Lee WR, Shen SC, Yeh KT, Jiang MC, Tseng JT.
International Journal of Clinical and Experimental Pathology 2015 Feb; 8(2):1393.
Application:IHC-P, Human, Melanomas.
-
CSE1L modulates Ras-induced cancer cell invasion: correlation of K-Ras mutation and CSE1L expression in colorectal cancer progression.
Jiang MC, Yeh CM, Tai CJ, Chen HC, Lin SH, Su TC, Shen SC, Lee WR, Liao CF, Li LT, Lee CH, Chen YC, Yeh KT, Chang CC.
American Journal of Surgery 2013 Sep; 206(3):418.
Application:IHC-P, Human, Colorectal.
-
MIR-137 Suppresses Growth and Invasion, is Downregulated in Oligodendroglial Tumors and Targets CSE1L.
Li KK, Yang L, Pang JC, Chan AK, Zhou L, Mao Y, Wang Y, Lau KM, Poon WS, Shi Z, Ng HK.
Brain Pathology 2013 Jan; 23(4):426.
Application:WB-Ce, Human, HOG, TC620, GOS-3, LNZ308, A172, U87, U373.
-
The prognostic significance of nuclear CSE1L in urinary bladder urothelial carcinomas.
Chang CC, Tai CJ, Su TC, Shen KH, Lin SH, Yeh CM, Yeh KT, Lin YM, Jiang MC.
Annals of Diagnostic Pathology 2012 Oct; 16(5):362.
Application:IHC-P, Human, Human bladder cancer.
-
Differential distributions of CSE1L/CAS and E-cadherin in the polarized and non-polarized epithelial glands of neoplastic colorectal epithelium.
Uen WC, Tai CJ, Shen SC, Lee WR, Tsao TY, Deng WP, Chiou HY, Hsu CH, Hsieh CI, Liao CF, Jiang MC.
Journal of Molecular Histology 2010 Oct; 41(4-5):257.
Application:IHC-P, WB, Human, HT-29 cells, Human colorectal epithelium, Recombinant protein.
-
Serum Cellular Apoptosis Susceptibility Protein Is a Potential Prognostic Marker for Metastatic Colorectal Cancer.
Stella Tsai CS, Chen HC, Tung JN, Tsou SS, Tsao TY, Liao CF, Chen YC, Yeh CY, Yeh KT, Jiang MC.
The American Journal of Pathology 2010 Apr; 176(4):1619.
Application:IF, IHC-P, WB, Human, Mouse, HT-29 cells, Human colorectal cancer, Mouse xenograft tumors, Serum.
-
Higher Prevalence of Secretory CSE1L/CAS in Sera of Patients with Metastatic Cancer.
Tung MC, Tsai CS, Tung JN, Tsao TY, Chen HC, Yeh KT, Liao CF, Jiang MC.
Cancer Epidemiology, Biomarkers & Prevention 2009 May; 18(5):1570.
Application:IHC-P, Human, Human breast cancer, Human colon cancer.
-
Function of CSE1L/CAS in the secretion of HT-29 human colorectal cells and its expression in human colon.
Tsao TY, Tsai CS, Tung JN, Chen SL, Yue CH, Liao CF, Wang CC, Jiang MC.
Molecular and Cellular Biochemistry 2009 Jul; 327(1-2):163.
Application:IF, IHC-P, WB, Human, HEK 293, HT-29, HT-CAS, HT-EV cells, Human colon cancer.
-
Oncogenic Ras expression increases cytoplasmic distribution and phosphorylation of CSE1L in B16F10 melanoma cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com