CLK3 monoclonal antibody (M01), clone 1H2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CLK3.
Immunogen
CLK3 (AAH02555, 36 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CLK3 monoclonal antibody (M01), clone 1H2. Western Blot analysis of CLK3 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
CLK3 monoclonal antibody (M01), clone 1H2 Western Blot analysis of CLK3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CLK3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.2 ug/ml]ELISA
-
Gene Info — CLK3
Entrez GeneID
1198GeneBank Accession#
BC002555Protein Accession#
AAH02555Gene Name
CLK3
Gene Alias
FLJ22858, PHCLK3, PHCLK3/152
Gene Description
CDC-like kinase 3
Omim ID
602990Gene Ontology
HyperlinkGene Summary
This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Two transcript variants encoding different isoforms have been found for this gene. Related pseudogenes are located on chromosomes 1 and 9. [provided by RefSeq
Other Designations
dual specificity protein kinase CLK3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com