AP1S1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human AP1S1 full-length ORF ( AAH03561, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MMRFMLLFSRQGKLRLRKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSTFPFSH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
40.37
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — AP1S1
Entrez GeneID
1174GeneBank Accession#
BC003561Protein Accession#
AAH03561Gene Name
AP1S1
Gene Alias
AP19, CLAPS1, FLJ92436, SIGMA1A, WUGSC:H_DJ0747G18.2
Gene Description
adaptor-related protein complex 1, sigma 1 subunit
Omim ID
603531Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle. [provided by RefSeq
Other Designations
AP-1 complex subunit sigma-1A|HA1 19 kDa subunit|clathrin assembly protein complex 1 sigma-1A small chain|clathrin coat assembly protein AP19|clathrin-associated/assembly/adaptor protein, small 1 (19kD)|golgi adaptor HA1/AP1 adaptin sigma-1A subunit|sigma
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com