CHRNA5 monoclonal antibody (M01), clone 7D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CHRNA5 expression in transfected 293T cell line by CHRNA5 monoclonal antibody (M01), clone 7D3.
Lane 1: CHRNA5 transfected lysate (Predicted MW: 53.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CHRNA5 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.08 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CHRNA5.
Immunogen
CHRNA5 (NP_000736, 38 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (90)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CHRNA5 expression in transfected 293T cell line by CHRNA5 monoclonal antibody (M01), clone 7D3.
Lane 1: CHRNA5 transfected lysate (Predicted MW: 53.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CHRNA5 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — CHRNA5
Entrez GeneID
1138GeneBank Accession#
NM_000745Protein Accession#
NP_000736Gene Name
CHRNA5
Gene Alias
LNCR2
Gene Description
cholinergic receptor, nicotinic, alpha 5
Omim ID
118505Gene Ontology
HyperlinkGene Summary
Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits. See MIM 118508 for additional background information on AChRs.[supplied by OMIM
Other Designations
Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5|cholinergic receptor, nicotinic, alpha polypeptide 5|neuronal nicotinic acetylcholine receptor, alpha5 subunit
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com