CDKN2C (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human CDKN2C full-length ORF ( AAH16173, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHMASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
44.22
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CDKN2C
Entrez GeneID
1031GeneBank Accession#
BC016173Protein Accession#
AAH16173Gene Name
CDKN2C
Gene Alias
INK4C, p18, p18-INK4C
Gene Description
cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
Omim ID
603369Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq
Other Designations
CDK6 inhibitor p18|OTTHUMP00000009730|OTTHUMP00000009731|OTTHUMP00000046546|cyclin-dependent inhibitor|cyclin-dependent kinase 4 inhibitor C|cyclin-dependent kinase 6 inhibitor p18|cyclin-dependent kinase inhibitor 2C
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com