CDK8 monoclonal antibody (M03), clone 5H4

Catalog # H00001024-M03

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

CDK8 monoclonal antibody (M03), clone 5H4. Western Blot analysis of CDK8 expression in NIH/3T3 ( Cat # L018V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

CDK8 monoclonal antibody (M03), clone 5H4. Western Blot analysis of CDK8 expression in Jurkat ( Cat # L017V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

CDK8 monoclonal antibody (M03), clone 5H4. Western Blot analysis of CDK8 expression in PC-12 ( Cat # L012V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

CDK8 monoclonal antibody (M03), clone 5H4 Western Blot analysis of CDK8 expression in Hela S3 NE ( Cat # L013V3 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

CDK8 monoclonal antibody (M03), clone 5H4. Western Blot analysis of CDK8 expression in K-562 ( Cat # L009V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

CDK8 monoclonal antibody (M03), clone 5H4. Western Blot analysis of CDK8 expression in Raw 264.7 ( Cat # L024V1 ).

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged CDK8 is approximately 0.03ng/ml as a capture antibody.

QC Test

Western Blot detection against Immunogen (35.53 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant CDK8.

    Immunogen

    CDK8 (NP_001251, 375 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY

    Host

    Mouse

    Reactivity

    Human, Mouse, Rat

    Interspecies Antigen Sequence

    Mouse (98); Rat (98)

    Isotype

    IgG1 Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (35.53 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    CDK8 monoclonal antibody (M03), clone 5H4. Western Blot analysis of CDK8 expression in NIH/3T3 ( Cat # L018V1 ).

    Western Blot (Cell lysate)

    CDK8 monoclonal antibody (M03), clone 5H4. Western Blot analysis of CDK8 expression in Jurkat ( Cat # L017V1 ).

    Western Blot (Cell lysate)

    CDK8 monoclonal antibody (M03), clone 5H4. Western Blot analysis of CDK8 expression in PC-12 ( Cat # L012V1 ).

    Western Blot (Cell lysate)

    CDK8 monoclonal antibody (M03), clone 5H4 Western Blot analysis of CDK8 expression in Hela S3 NE ( Cat # L013V3 ).

    Western Blot (Cell lysate)

    CDK8 monoclonal antibody (M03), clone 5H4. Western Blot analysis of CDK8 expression in K-562 ( Cat # L009V1 ).

    Western Blot (Cell lysate)

    CDK8 monoclonal antibody (M03), clone 5H4. Western Blot analysis of CDK8 expression in Raw 264.7 ( Cat # L024V1 ).

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged CDK8 is approximately 0.03ng/ml as a capture antibody.

    ELISA

  • Gene Info — CDK8

    Entrez GeneID

    1024

    GeneBank Accession#

    NM_001260

    Protein Accession#

    NP_001251

    Gene Name

    CDK8

    Gene Alias

    K35, MGC126074, MGC126075

    Gene Description

    cyclin-dependent kinase 8

    Omim ID

    603184

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit cyclin C are components of the RNA polymerase II holoenzyme complex, which phosphorylates the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II. This kinase has also been shown to regulate transcription by targeting the CDK7/cyclin H subunits of the general transcription initiation factor IIH (TFIIH), thus providing a link between the 'Mediator-like' protein complexes and the basal transcription machinery. [provided by RefSeq

    Other Designations

    CDK8 protein kinase|OTTHUMP00000018158|cell division protein kinase 8|protein kinase K35

  • Interactome
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All