CD59 purified MaxPab mouse polyclonal antibody (B02P)

Catalog # H00000966-B02P

Size

Price

Stock

Quantity

Size:50 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of CD59 expression in transfected 293T cell line (H00000966-T02) by CD59 MaxPab polyclonal antibody.

Lane 1: CD59 transfected lysate(14.08 KDa).
Lane 2: Non-transfected lysate.

  • Specification

    Product Description

    Mouse polyclonal antibody raised against a full-length human CD59 protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    CD59 (NP_000602.1, 1 a.a. ~ 128 a.a) full-length human protein.

    Sequence

    MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP

    Host

    Mouse

    Reactivity

    Human

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Transfected lysate)

    Western Blot analysis of CD59 expression in transfected 293T cell line (H00000966-T02) by CD59 MaxPab polyclonal antibody.

    Lane 1: CD59 transfected lysate(14.08 KDa).
    Lane 2: Non-transfected lysate.
  • Gene Info — CD59

    Entrez GeneID

    966

    GeneBank Accession#

    NM_000611

    Protein Accession#

    NP_000602.1

    Gene Name

    CD59

    Gene Alias

    16.3A5, 1F5, EJ16, EJ30, EL32, FLJ38134, FLJ92039, G344, HRF-20, HRF20, MAC-IP, MACIF, MEM43, MGC2354, MIC11, MIN1, MIN2, MIN3, MIRL, MSK21, p18-20

    Gene Description

    CD59 molecule, complement regulatory protein

    Omim ID

    107271

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq

    Other Designations

    20 kDa homologous restriction factor|CD59 antigen|CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344)|CD59 glycoprotein|Ly-6-like protein|T cell-activating protein|human leukocyte antigen MIC11|lymphocytic a

  • Interactome
  • Pathway
  • Disease
  • Publication Reference
    • All Major Cholesterol-Dependent Cytolysins Use Glycans as Cellular Receptors.

      Lucy K Shewell, Christopher J Day, Freda E-C Jen, Thomas Haselhorst, John M Atack, Josephine F Reijneveld, Arun Everest-Dass, David B A James, Kristina M Boguslawski, Stephan Brouwer, Christine M Gillen, Zhenyao Luo, Bostjan Kobe, Victor Nizet, Mark von Itzstein, Mark J Walker, Adrienne W Paton, James C Paton, Victor J Torres, Michael P Jennings.

      Science Advances 2020 May; 6(21):eaaz4926.

      Application:WB-Ce, Human, Mouse reticulocytes.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All