MS4A3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MS4A3 protein.
Immunogen
MS4A3 (AAH08487, 1 a.a. ~ 214 a.a) full-length human protein.
Sequence
MASHEVDNAELGSASARGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSPPNSV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (64); Rat (60)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MS4A3 expression in transfected 293T cell line (H00000932-T01) by MS4A3 MaxPab polyclonal antibody.
Lane 1: MS4A3 transfected lysate(23.65 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MS4A3
Entrez GeneID
932GeneBank Accession#
BC008487Protein Accession#
AAH08487Gene Name
MS4A3
Gene Alias
CD20L, HTM4
Gene Description
membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific)
Omim ID
606498Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member likely plays a role in signal transduction and may function as a subunit associated with receptor complexes. The gene encoding this protein is localized to 11q12, among a cluster of related family members. Alternative splicing may result in multiple transcript variants; however, not all variants have been fully described. [provided by RefSeq
Other Designations
CD20 antigen homolog|CD20 antigen-like|IgE receptor beta chain|IgE receptor beta subunit|hematopoietic cell 4 transmembrane protein|membrane-spanning 4-domains subfamily A member 3|membrane-spanning 4-domains, subfamily A, member 3
-
Interactome
-
Disease
-
Publication Reference
-
Human Eosinophils Express the High Affinity IgE Receptor, FcεRI, in Bullous Pemphigoid.
Messingham KN, Holahan HM, Frydman AS, Fullenkamp C, Srikantha R, Fairley JA.
PLoS One 2014 Sep; 9(9):e107725.
Application:Flow Cyt, PLA, Human, Eosinophils.
-
Human Eosinophils Express the High Affinity IgE Receptor, FcεRI, in Bullous Pemphigoid.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com