CACNA1C (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CACNA1C partial ORF ( NP_000710, 2039 a.a. - 2138 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
AVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (82); Rat (83)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CACNA1C
Entrez GeneID
775GeneBank Accession#
NM_000719Protein Accession#
NP_000710Gene Name
CACNA1C
Gene Alias
CACH2, CACN2, CACNL1A1, CCHL1A1, CaV1.2, MGC120730, TS
Gene Description
calcium channel, voltage-dependent, L type, alpha 1C subunit
Gene Ontology
HyperlinkGene Summary
This gene encodes an alpha-1 subunit of a voltage-dependent calcium channel. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization. The alpha-1 subunit consists of 24 transmembrane segments and forms the pore through which ions pass into the cell. The calcium channel consists of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. There are multiple isoforms of each of these proteins, either encoded by different genes or the result of alternative splicing of transcripts. The protein encoded by this gene binds to and is inhibited by dihydropyridine. Alternative splicing results in many transcript variants encoding different proteins. [provided by RefSeq
Other Designations
DHPR, alpha-1 subunit|calcium channel, L type, alpha 1 polypeptide, isoform 1, cardic muscle|calcium channel, cardic dihydropyridine-sensitive, alpha-1 subunit|voltage-gated L-type calcium channel Cav1.2 alpha 1 subunit, splice variant 10*|voltage-gated c
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com