PTTG1IP (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PTTG1IP full-length ORF ( AAH20983, 1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
45.54
Interspecies Antigen Sequence
Mouse (74); Rat (78)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PTTG1IP
Entrez GeneID
754GeneBank Accession#
BC020983Protein Accession#
AAH20983Gene Name
PTTG1IP
Gene Alias
C21orf1, C21orf3, PBF
Gene Description
pituitary tumor-transforming 1 interacting protein
Omim ID
603784Gene Ontology
HyperlinkGene Summary
The encoded protein, which directly binds to pituitary tumor-transforming gene 1 protein (PTTG1), facilitates the nuclear translocation of PTTG1 and potentiates the transcriptional activation of basic fibroblast growth factor by PTTG1. The gene product localizes to both the cytoplasm and nucleus. Its NLS is required for its own nuclear localization, the nuclear localization of PTTG1, and its interaction with PTTG1. [provided by RefSeq
Other Designations
PTTG-binding factor|pituitary tumor-transforming gene 1 protein-interacting protein|pituitary tumor-transforming gene protein-binding factor
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com