BGN monoclonal antibody (M01), clone 4E1-1G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant BGN.
Immunogen
BGN (AAH02416.1, 1 a.a. ~ 368 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Host
Mouse
Reactivity
Human
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (66.22 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BGN monoclonal antibody (M01), clone 4E1-1G7 Western Blot analysis of BGN expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of BGN expression in transfected 293T cell line by BGN monoclonal antibody (M01), clone 4E1-1G7.
Lane 1: BGN transfected lysate(41.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BGN on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. [antibody concentration 1 ~ 10 ug/ml]Immunoprecipitation
Immunoprecipitation of BGN transfected lysate using anti-BGN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BGN MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BGN is 0.03 ng/ml as a capture antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BGN is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — BGN
Entrez GeneID
633GeneBank Accession#
BC002416Protein Accession#
AAH02416.1Gene Name
BGN
Gene Alias
DSPG1, PG-S1, PGI, SLRR1A
Gene Description
biglycan
Omim ID
301870Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The encoded protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached glycosaminoglycan chain, while this protein probably contains two chains. For this reason, this protein is called biglycan. This protein is thought to function in connective tissue metabolism by binding to collagen fibrils and transfering growth factor-beta. It may promote neuronal survival. This gene is a candidate gene for the Happle syndrome. [provided by RefSeq
Other Designations
OTTHUMP00000025928|biglycan proteoglycan|bone/cartilage proteoglycan-I|dermatan sulphate proteoglycan I|small leucine-rich protein 1A
-
Interactome
-
Publication Reference
-
Deep learning neural network image analysis of immunohistochemical protein expression reveals a significantly reduced expression of biglycan in breast cancer.
Ana Paula Thiesen, Bruna Mielczarski, Ricardo Francalacci Savaris.
PLoS One 2023 Mar; 18(3):e0282176.
Application:IHC-P, Human, Human breast tissue, Human breast cancer tissue.
-
Breast cancer dataset with biomarker Biglycan.
Pedro Clarindo da Silva Neto, Rafael Kunst, Jorge Luis Victoria Barbosa, Ana Paula Thiesen Leindecker, Ricardo F Savaris.
Data in Brief 2023 Apr; 47:108978.
Application:IHC-P, Human, Human breast tissue, Human breast cancer tissue.
-
The Small Leucine-Rich Proteoglycan BGN Accumulates in CADASIL and Binds to NOTCH3.
Zhang X, Lee SJ, Young MF, Wang MM.
Translational Stroke Research 2015 Apr; 6(2):148.
Application:IHC, Human, Frontal cortex.
-
Deep learning neural network image analysis of immunohistochemical protein expression reveals a significantly reduced expression of biglycan in breast cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com