BAK1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human BAK1 full-length ORF ( NP_001179.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
49.8
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — BAK1
Entrez GeneID
578GeneBank Accession#
NM_001188.3Protein Accession#
NP_001179.1Gene Name
BAK1
Gene Alias
BAK, BAK-LIKE, BCL2L7, CDN1, MGC117255, MGC3887
Gene Description
BCL2-antagonist/killer 1
Omim ID
600516Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. [provided by RefSeq
Other Designations
BCL2-like 7 protein|Bcl-2 homologous antagonist/killer|OTTHUMP00000016211|OTTHUMP00000039620|apoptosis regulator BAK|pro-apoptotic protein BAK
-
Interactome
-
Disease
-
Publication Reference
-
Systems Analysis of BCL2 Protein Family Interactions Establishes a Model to Predict Responses to Chemotherapy.
Lindner AU, Concannon CG, Boukes GJ, Cannon MD, Llambi F, Ryan D, Boland K, Kehoe J, McNamara DA, Murray F, Kay EW, Hector S, Green DR, Huber HJ, Prehn JH.
Cancer Research 2013 Jan; 73(2):519.
Application:Quan, Human, HeLa.
-
Systems Analysis of BCL2 Protein Family Interactions Establishes a Model to Predict Responses to Chemotherapy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com