ATP5G1 monoclonal antibody (M01), clone 1A12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ATP5G1.
Immunogen
ATP5G1 (AAH04963, 18 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TRGLIRPVSASFLSSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (91)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.83 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — ATP5G1
Entrez GeneID
516GeneBank Accession#
BC004963Protein Accession#
AAH04963Gene Name
ATP5G1
Gene Alias
ATP5A, ATP5G
Gene Description
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9)
Omim ID
603192Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq
Other Designations
ATP synthase lipid-binding protein, mitochondrial|ATP synthase proteolipid P1|ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1|ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1|ATPase protein 9|AT
-
Interactome
-
Pathway
-
Publication Reference
-
Neuronal cell surface ATP synthase mediates synthesis of extracellular ATP and regulation of intracellular pH.
Xing SL, Yan J, Yu ZH, Zhu CQ.
Cell Biology International 2011 Jan; 35(1):81.
Application:WB, Rat, Primary cultured neurons.
-
Neuronal cell surface ATP synthase mediates synthesis of extracellular ATP and regulation of intracellular pH.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com