ASPH purified MaxPab rabbit polyclonal antibody (D03P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ASPH protein.
Immunogen
ASPH (NP_115856.1, 1 a.a. ~ 210 a.a) full-length human protein.
Sequence
MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEELKKEKEKPESRKESKNEERKKGKKEDVRKDKKIADADLSRKESPKGKKDREKEKVDLEKSAKTKENRKKSTNMKDVSSKMASRDKDDRKESRSSTRYAHLTKGNTQKRNG
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ASPH expression in transfected 293T cell line (H00000444-T03) by ASPH MaxPab polyclonal antibody.
Lane 1: ASPH transfected lysate(23.80 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ASPH
Entrez GeneID
444GeneBank Accession#
NM_032467.1Protein Accession#
NP_115856.1Gene Name
ASPH
Gene Alias
BAH, CASQ2BP1, HAAH, JCTN, junctin
Gene Description
aspartate beta-hydroxylase
Omim ID
600582Gene Ontology
HyperlinkGene Summary
This gene is thought to play an important role in calcium homeostasis. The gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis. [provided by RefSeq
Other Designations
aspartyl/asparaginyl-beta-hydroxylase|humbug|junctate|peptide-aspartate beta-dioxygenase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com