AMBP monoclonal antibody (M01), clone 3F1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
AMBP monoclonal antibody (M01), clone 3F1 Western Blot analysis of AMBP expression in A-549 ( Cat # L025V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of AMBP expression in transfected 293T cell line by AMBP monoclonal antibody (M01), clone 3F1.
Lane 1: AMBP transfected lysate(39 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to AMBP on formalin-fixed paraffin-embedded human liver. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AMBP is approximately 1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to AMBP on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (62.48 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant AMBP.
Immunogen
AMBP (AAH41593, 19 a.a. ~ 352 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AGPVPTPPDNIQVQGNFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (77)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (62.48 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AMBP monoclonal antibody (M01), clone 3F1 Western Blot analysis of AMBP expression in A-549 ( Cat # L025V1 ).Western Blot (Transfected lysate)
Western Blot analysis of AMBP expression in transfected 293T cell line by AMBP monoclonal antibody (M01), clone 3F1.
Lane 1: AMBP transfected lysate(39 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to AMBP on formalin-fixed paraffin-embedded human liver. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AMBP is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to AMBP on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — AMBP
Entrez GeneID
259GeneBank Accession#
BC041593Protein Accession#
AAH41593Gene Name
AMBP
Gene Alias
EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI
Gene Description
alpha-1-microglobulin/bikunin precursor
Omim ID
176870Gene Ontology
HyperlinkGene Summary
This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes. [provided by RefSeq
Other Designations
OTTHUMP00000021967|OTTHUMP00000063975|alpha-1-microglobulin/bikunin|bikunin|complex-forming glycoprotein heterogeneous in charge|growth-inhibiting protein 19|inter-alpha-trypsin inhibitor light chain|protein HC|trypstatin|uristatin|uronic-acid-rich protei
-
Interactome
-
Disease
-
Publication Reference
-
Differential proteomics analysis of amniotic fluid in pregnancies of increased nuchal translucency with normal karyotype.
Cheng PJ, Wang TH, Huang SY, Kao CC, Lu JH, Hsiao CH, Steven Shaw SW.
Prenatal Diagnosis 2011 Mar; 31(3):274.
Application：WB, Human, Amniotic fluid supernatant.
-
Differential proteomics analysis of amniotic fluid in pregnancies of increased nuchal translucency with normal karyotype.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com