AKR1B1 monoclonal antibody (M03), clone 2D12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant AKR1B1.
Immunogen
AKR1B1 (AAH00260.1, 1 a.a. ~ 316 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (86)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (60.39 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to AKR1B1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AKR1B1 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — AKR1B1
Entrez GeneID
231GeneBank Accession#
BC000260.1Protein Accession#
AAH00260.1Gene Name
AKR1B1
Gene Alias
ADR, ALDR1, ALR2, AR, MGC1804
Gene Description
aldo-keto reductase family 1, member B1 (aldose reductase)
Omim ID
103880Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. [provided by RefSeq
Other Designations
Lii5-2 CTCL tumor antigen|aldehyde reductase 1|aldo-keto reductase family 1, member B1|aldose reductase|low Km aldose reductase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Endogenous reductase activities for the generation of ribitol-phosphate, a CDP-ribitol precursor, in mammals.
Shunsuke Hoshino, Hiroshi Manya, Rieko Imae, Kazuhiro Kobayashi, Motoi Kanagawa, Tamao Endo.
Journal of Biochemistry 2023 Dec; Epub.
Application:WB, Human, HEK293T cells.
-
Proteasome inhibitors MG-132 and bortezomib induce AKR1C1; AKR1C3; AKR1B1; and AKR1B10 in human colon cancer cell lines SW-480 and HT-29.
Ebert B, Kisiela M, Wsol V, Maser E.
Chemico-biological Interactions 2011 May; 191(1-3):239.
Application:WB, Human, Caco-2, HT-29, HCT116, SW-480, A-549, PANC-1, A431, HepG2 cells.
-
Endogenous reductase activities for the generation of ribitol-phosphate, a CDP-ribitol precursor, in mammals.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com