APLNR purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of APLNR expression in transfected 293T cell line (H00000187-T03) by APLNR MaxPab polyclonal antibody.
Lane 1: APLNR transfected lysate(41.8 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human APLNR protein.
Immunogen
APLNR (ABM81770.1, 1 a.a. ~ 380 a.a) full-length human protein.
Sequence
MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of APLNR expression in transfected 293T cell line (H00000187-T03) by APLNR MaxPab polyclonal antibody.
Lane 1: APLNR transfected lysate(41.8 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — APLNR
Entrez GeneID
187GeneBank Accession#
DQ890844.2Protein Accession#
ABM81770.1Gene Name
APLNR
Gene Alias
AGTRL1, APJ, APJR, FLJ90771, MGC45246
Gene Description
apelin receptor
Omim ID
600052Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the G protein-coupled receptor gene family. The encoded protein is related to the angiotensin receptor, but is actually an apelin receptor that inhibits adenylate cyclase activity and plays a counter-regulatory role against the pressure action of angiotensin II by exerting hypertensive effect. It functions in the cardiovascular and central nervous systems, in glucose metabolism, in embryonic and tumor angiogenesis and as a human immunodeficiency virus (HIV-1) coreceptor. Two transcript variants resulting from alternative splicing have been identified. [provided by RefSeq
Other Designations
APJ (apelin) receptor|angiotensin II receptor-like 1|angiotensin receptor-like 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com