ADORA3 monoclonal antibody (M01), clone 1A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ADORA3.
Immunogen
ADORA3 (AAH29831, 121 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGRE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ADORA3 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — ADORA3
Entrez GeneID
140GeneBank Accession#
BC029831Protein Accession#
AAH29831Gene Name
ADORA3
Gene Alias
A3AR, AD026, bA552M11.5
Gene Description
adenosine A3 receptor
Omim ID
600445Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000013476|OTTHUMP00000013739|OTTHUMP00000082917
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Preclinical In Vitro and In Vivo Evaluation of [18F]FE@SUPPY for Cancer PET Imaging: Limitations of a Xenograft Model for Colorectal Cancer.
Balber T, Singer J, Berroterán-Infante N, Dumanic M, Fetty L, Fazekas-Singer J, Vraka C, Nics L, Bergmann M, Pallitsch K, Spreitzer H, Wadsak W, Hacker M, Jensen-Jarolim E, Viernstein H, Mitterhauser M.
Contrast Media & Molecular Imaging 2018 Feb; 2018:1269830.
Application:Flow Cyt, Human, HT-29 cells.
-
Adenosine receptor expression in rheumatoid synovium: a basis for methotrexate action.
Stamp LK, Hazlett J, Roberts RL, Frampton C, Highton J, Hessian PA.
Arthritis Research & Therapy 2012 Jun; 14(3):R138.
Application:IF, IHC, Human, Synovial tissue from patients with rheumatoid arthritis.
-
Preclinical In Vitro and In Vivo Evaluation of [18F]FE@SUPPY for Cancer PET Imaging: Limitations of a Xenograft Model for Colorectal Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com