Produkt-Browser

Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

VEGFA (Human) Recombinant Protein   BioActive

  • Katalog # : P4444
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 10 ug
  • EUR € 179
  • Stock Image
  • order now, ship in 5 days
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Human VEGFA (P15692-9) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR
  • Theoretical MW (kDa):
  • 28.4
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.01 ng/ug or < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose dependent proliferation of HUVECs. The expected ED50 for this effect is 3.1-4.6 ng/mL.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Serial dilutions of human VEGFA (starting at 100 ng/mL) were added to HUVEC cells cultured without EGF. After 88 hours, cell proliferation was measured and the linear portion of the curve was us used to calculate the ED50.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7422
  • Gene Name:
  • VEGFA
  • Gene Alias:
  • MGC70609,VEGF,VEGF-A,VPF
  • Gene Description:
  • vascular endothelial growth factor A
  • Gene Summary:
  • This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms. [provided by RefSeq
  • Other Designations:
  • vascular endothelial growth factor isoform VEGF165,vascular permeability factor
  • Related Disease
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!