Produkt-Browser

Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

EGF (Human) Recombinant Protein   BioActive

  • Katalog # : P4381
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 500 ug
  • EUR € 229
  • Stock Image
  • order now, ship in 5 days
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Human EGF (P01133) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
  • Theoretical MW (kDa):
  • 6.2
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.01 ng/ug or < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent proliferation of murine BALB/c 3T3 cells. The expected ED50 for this effect is 16-24 pg/mL.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • 3T3 cells were cultured with 0 to 1 ng/mL human EGF. Cell proliferation was measured after 40 hours and the linear portion of the curve was us used to calculate the ED50.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 1950
  • Gene Name:
  • EGF
  • Gene Alias:
  • HOMG4,URG
  • Gene Description:
  • epidermal growth factor (beta-urogastrone)
  • Gene Summary:
  • Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. [provided by RefSeq
  • Other Designations:
  • urogastrone
  • Related Disease
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!