- Products
- Services
- Support
- Zusammenarbeit
- Über uns
Produkt-Browser
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25895)
- MaxPab® Ab (16205)
- Monoclonal Ab (21428)
- Polyclonal Ab (27861)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7710)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2004)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2136)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (18054)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
 |
 |
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Proteins/Peptides > Human > Bioactive > Apoptosis > IFNA2 (Human) Recombinant Protein
IFNA2 (Human) Recombinant Protein 
- Katalog # : P3622
- Visit Frequency :
- Größe
- Preis
- In Stock
- Verfügbarkeit
- Cart
- 100 ug
- EUR € 229
- order now, ship in 5 days
-
-
- Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
- Fragen Sie uns
- Zahlungsinformationen
Kreditkarte :
oder Bestellnummer
Email : sales@abnova.com
Phone : +49-6221-825877
Fax : +49-2381-9994411- Produkte werden direkt an den Kunden versandt.
- Specification
- Product Description:
- Human IFNA2 (P01563, 24 a.a. - 188 a.a.) partial recombinant protein expressed in Escherichia coli.
- Sequence:
- CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
- Theoretical MW (kDa):
- 19
- Form:
- Lyophilized
- Preparation Method:
- Escherichia coli expression system
- Purification:
- Ion exchange column and HPLC reverse phase column
- Purity:
- > 98% by SDS-PAGE and HPLC
- Endotoxin Level:
- < 0.1 ng/ug (1 EU/ug)
- Activity:
- The ED50 was determined by viral resistance assay and was found to be not less than 5 x 108 IU/mg.
- Storage Buffer:
- Lyophilized from PBS, pH 7.0
- Storage Instruction:
- Store at -20°C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing.
- Application Image
- Functional Study
- SDS-PAGE
