Produkt-Browser
PNPO polyclonal antibody (A01)
Katalog # : H00055163-A01
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
50 uL
EUR € 195
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Mouse polyclonal antibody raised against a partial recombinant PNPO.
Immunogen: PNPO (NP_060599, 163 a.a. ~ 261 a.a) partial recombinant protein with GST tag.
Sequence: KSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP
Quality Control Testing: Antibody Reactive Against Recombinant Protein.
Storage Buffer: 50 % glycerol
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
1.
Toxicological biomarkers of 2,3,4,7,8-pentachlorodibenzofuran in proteins secreted by HepG2 cells.
Western Blot (Cell lysate) PNPO polyclonal antibody (A01), Lot # 060529JCS1 Western Blot analysis of PNPO expression in MES-SA/Dx5 ( Cat # L021V1 ).
Protocol Download
Western Blot (Recombinant protein)
Gene Alias: FLJ10535,PDXPO
Gene Description: pyridoxamine 5'-phosphate oxidase
Gene Summary: The enzyme encoded by this gene catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine. Mutations in this gene result in pyridoxamine 5'-phosphate oxidase (PNPO) deficiency, a form of neonatal epileptic encephalopathy. [provided by RefSeq
Other Designations: pyridoxal 5'-phosphate synthase,pyridoxine 5'-phosphate oxidase
Click this icon to add products to compare list. Select up to 10 products.
Download
