Produkt-Browser
Click this icon to add products to compare list. Select up to 10 products.
DIRAS2 polyclonal antibody (A01)
- Katalog # : H00054769-A01
- Visit Frequency :
- Größe
- Preis
- In Stock
- Verfügbarkeit
- Cart
- 50 uL
-
EUR € 195
- order now, ship next day
-
-
- Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
- Fragen Sie uns
- Zahlungsinformationen
Kreditkarte : 
oder Bestellnummer
Email : sales@abnova.com
Phone : +49-6221-825877
Fax : +49-2381-9994411- Produkte werden direkt an den Kunden versandt.
- Product Description:
- Mouse polyclonal antibody raised against a partial recombinant DIRAS2.
- Immunogen:
- DIRAS2 (NP_060064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
- Sequence:
- AFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDG
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
- Storage Buffer:
- 50 % glycerol
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Western Blot (Transfected lysate)
- Western Blot analysis of DIRAS2 expression in transfected 293T cell line by DIRAS2 polyclonal antibody (A01).
Lane1:DIRAS2 transfected lysate (Predicted MW: 22.5 KDa).
Lane2:Non-transfected lysate.
-
Protocol Download
- Western Blot (Transfected lysate)
- enlarge
- Western Blot (Recombinant protein)
- Gene Alias:
- DKFZp761C07121,Di-Ras2
- Gene Description:
- DIRAS family, GTP-binding RAS-like 2
- Gene Summary:
- DIRAS2 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM
- Other Designations:
- Di-Ras2,OTTHUMP00000021626
Download
