Produkt-Browser
TH1L (Human) Recombinant Protein (Q01)
Katalog # : H00051497-Q01
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
10 ug
EUR € 279
order now, ship in 5 days
25 ug
EUR € 425
order now, ship in 5 days
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Human TH1L partial ORF ( NP_057481.2, 491 a.a. - 590 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence: ELKKTLLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPYTSDFVQLFLPILENDSIAGTIKTEGEHDPVTEFIAHCKSNFIMVN
Theoretical MW (kDa): 36.74
Purification: Glutathione Sepharose 4 Fast Flow
Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note: Best use within three months from the date of receipt of this protein.
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Gene Alias: HSPC130,NELF-C,NELF-D,TH1
Gene Description: TH1-like (Drosophila)
Gene Summary: The NELF complex of proteins interacts with the DSIF protein complex to repress transcriptional elongation by RNA polymerase II. The protein encoded by this gene is an essential part of the NELF complex. Alternative translation initiation site usage results in the formation of two isoforms with different N-termini. [provided by RefSeq
Other Designations: OTTHUMP00000031415,TH1 drosophila homolog,TH1-like protein,negative elongation factor proteins C and D
Click this icon to add products to compare list. Select up to 10 products.
Download
