Produkt-Browser
Click this icon to add products to compare list. Select up to 10 products.
HECTD1 monoclonal antibody (M03), clone 1E10
- Katalog # : H00025831-M03
- Visit Frequency :
- Größe
- Preis
- In Stock
- Verfügbarkeit
- Cart
- 100 ug
-
EUR € 299
- order now, ship next day
-
-
- Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
- Fragen Sie uns
- Zahlungsinformationen
Kreditkarte : 
oder Bestellnummer
Email : sales@abnova.com
Phone : +49-6221-825877
Fax : +49-2381-9994411- Produkte werden direkt an den Kunden versandt.
- Product Description:
- Mouse monoclonal antibody raised against a partial recombinant HECTD1.
- Immunogen:
- HECTD1 (NP_056197, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- DVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKIFLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVE
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Sandwich ELISA (Recombinant protein)
- Detection limit for recombinant GST tagged HECTD1 is approximately 0.3ng/ml as a capture antibody.
-
Protocol Download
- Western Blot (Recombinant protein)
- Sandwich ELISA (Recombinant protein)
- enlarge
- Gene Alias:
- FLJ38315,KIAA1131
- Gene Description:
- HECT domain containing 1
Download
