Produkt-Browser

  • Related Product Showcase
  • By Pathway
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

DKK1 monoclonal antibody (M01), clone 4D4   

  • Katalog # : H00022943-M01
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 100 ug
  • EUR € 299
  • Stock Image
  • order now, ship next day
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant DKK1.
  • Immunogen:
  • DKK1 (NP_036374, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • QPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00022943-M01
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • DKK1 monoclonal antibody (M01), clone 4D4 Western Blot analysis of DKK1 expression in HepG2 ( Cat # L019V1 ).
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • DKK1 monoclonal antibody (M01), clone 4D4. Western Blot analysis of DKK1 expression in Jurkat ( Cat # L017V1 ).
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged DKK1 is approximately 30ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DKK1
  • Gene Alias:
  • DKK-1,SK
  • Gene Description:
  • dickkopf homolog 1 (Xenopus laevis)
  • Gene Summary:
  • This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019617,dickkopf homolog 1,dickkopf related protein-1,dickkopf-1 like
  • Gene Pathway
    Wenn Sie Fragen oder Kommentare haben, wählen Sie bitte ein Thema aus.

Ihre Nachricht wurde erfolgreich gesendet!