Produkt-Browser

Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

TNFRSF10B (Human) Recombinant Protein   HuPro Protein

  • Katalog # : H00008795-H01
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 25 ug
  • EUR € 680
  • Stock Image
  • order now, ship next day
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Purified TNFRSF10B (AAH01281.1, 56 a.a. - 210 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293T cells
  • Sequence:
  • ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEAPAVEETVTSSPGTPASPCS
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 22.33
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-TNFRSF10B plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • > 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    SDS-PAGE Gel
    QC Testing of H00008795-H01

    Western Blot
    QC Testing of H00008795-H01
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 8795
  • Gene Name:
  • TNFRSF10B
  • Gene Alias:
  • CD262,DR5,KILLER,KILLER/DR5,TRAIL-R2,TRAILR2,TRICK2,TRICK2A,TRICK2B,TRICKB,ZTNFR9
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 10b
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Fas-like protein,OTTHUMP00000123492,TNF-related apoptosis-inducing ligand receptor 2,TRAIL receptor 2,apoptosis inducing protein TRICK2A/2B,apoptosis inducing receptor TRAIL-R2,cytotoxic TRAIL receptor-2,death domain containing receptor for TRAIL/Apo-2L,d
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!