Produkt-Browser
AP3B1 monoclonal antibody (M06), clone 3B4
Katalog # : H00008546-M06
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
100 ug
EUR € 299
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Mouse monoclonal antibody raised against a partial recombinant AP3B1.
Immunogen: AP3B1 (NP_003655, 995 a.a. ~ 1094 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence: KEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG
Quality Control Testing: Antibody Reactive Against Recombinant Protein.
Storage Buffer: In 1x PBS, pH 7.2
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Sandwich ELISA (Recombinant protein) Detection limit for recombinant GST tagged AP3B1 is approximately 0.3ng/ml as a capture antibody.
Protocol Download
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
enlarge
Gene Alias: ADTB3,ADTB3A,HPS,HPS2,PE
Gene Description: adaptor-related protein complex 3, beta 1 subunit
Gene Summary: This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is part of the heterotetrameric AP-3 protein complex which interacts with the scaffolding protein clathrin. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 2. [provided by RefSeq
Other Designations: AP-3 complex beta-3A subunit,beta3A-adaptin
Click this icon to add products to compare list. Select up to 10 products.
Download
