Produkt-Browser
Click this icon to add products to compare list. Select up to 10 products.
TUBB2A monoclonal antibody (M05), clone 3F9
- Katalog # : H00007280-M05
- Visit Frequency :
- Größe
- Preis
- In Stock
- Verfügbarkeit
- Cart
- 100 ug
-
EUR € 299
- order now, ship next day
-
-
- Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
- Fragen Sie uns
- Zahlungsinformationen
Kreditkarte : 
oder Bestellnummer
Email : sales@abnova.com
Phone : +49-6221-825877
Fax : +49-2381-9994411- Produkte werden direkt an den Kunden versandt.
- Product Description:
- Mouse monoclonal antibody raised against a full-length recombinant TUBB2A.
- Immunogen:
- TUBB2A (AAH01194, 1 a.a. ~ 445 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (74.47 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Western Blot (Cell lysate)
- TUBB2A monoclonal antibody (M05), clone 3F9. Western Blot analysis of TUBB2A expression in Jurkat(Cat # L017V1 ).
-
Protocol Download
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
enlarge this image- Immunoperoxidase of monoclonal antibody to TUBB2A on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]
-
Protocol Download
- Western Blot (Recombinant protein)
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- enlarge
- Gene Alias:
- TUBB,TUBB2,dJ40E16.7
- Gene Description:
- tubulin, beta 2A
- Other Designations:
- OTTHUMP00000015956,tubulin, beta 2,tubulin, beta polypeptide 2
Download
