Produkt-Browser

Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

TMSB4X polyclonal antibody (A02)   

  • Katalog # : H00007114-A02
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 50 uL
  • EUR € 195
  • Stock Image
  • order now, ship next day
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TMSB4X.
  • Immunogen:
  • TMSB4X (NP_066932, 1 a.a. ~ 44 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007114-A02
    Western Blot detection against Immunogen (30.95 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7114
  • Gene Name:
  • TMSB4X
  • Gene Alias:
  • FX,PTMB4,TB4X,TMSB4
  • Gene Description:
  • thymosin beta 4, X-linked
  • Gene Summary:
  • This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022925,OTTHUMP00000022926,OTTHUMP00000022927,OTTHUMP00000022928,prothymosin beta-4,thymosin beta-4,thymosin, beta 4,thymosin, beta 4, X chromosome
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!