Produkt-Browser

  • Related Product Showcase
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

TBP polyclonal antibody (A01)   

  • Katalog # : H00006908-A01
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 50 uL
  • EUR € 195
  • Stock Image
  • order now, ship next day
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TBP.
  • Immunogen:
  • TBP (NP_003185, 227 a.a. ~ 339 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006908-A01
    Western Blot detection against Immunogen (38.54 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6908
  • Gene Name:
  • TBP
  • Gene Alias:
  • GTF2D,GTF2D1,MGC117320,MGC126054,MGC126055,SCA17,TFIID
  • Gene Description:
  • TATA box binding protein
  • Gene Summary:
  • Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes TBP, the TATA-binding protein. A distinctive feature of TBP is a long string of glutamines in the N-terminal. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. Mutations that expand the number of CAG repeats encoding this polyglutamine tract, and thus increase the length of the polyglutamine string, are associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017703
    Wenn Sie Fragen oder Kommentare haben, wählen Sie bitte ein Thema aus.

Ihre Nachricht wurde erfolgreich gesendet!