Produkt-Browser
SNAI2 monoclonal antibody (M07), clone 2E10
Katalog # : H00006591-M07
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
100 ug
EUR € 299
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Mouse monoclonal antibody raised against a full-length recombinant SNAI2.
Immunogen: SNAI2 (NP_003059, 69 a.a. ~ 132 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence: LPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCN
Quality Control Testing: Antibody Reactive Against Recombinant Protein.
Storage Buffer: In 1x PBS, pH 7.2
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Sandwich ELISA (Recombinant protein) Detection limit for recombinant GST tagged SNAI2 is approximately 0.3ng/ml as a capture antibody.
Protocol Download
Sandwich ELISA (Recombinant protein)
enlarge
Gene Alias: MGC10182,SLUG,SLUGH1,WS2D
Gene Description: snail homolog 2 (Drosophila)
Gene Summary: This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. [provided by RefSeq
Other Designations: OTTHUMP00000195093,neural crest transcription factor SLUG,slug (chicken homolog), zinc finger protein,slug homolog, zinc finger protein,snail 2
Click this icon to add products to compare list. Select up to 10 products.
Download
