- Products
- Services
- Support
- Zusammenarbeit
- Über uns
Produkt-Browser
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16222)
- Monoclonal Ab (21397)
- Polyclonal Ab (27485)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
- By Research Area
- By Antibody/Protein
- By Application
 |
 |
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > MaxPab® Ab > Human > Binding > Nucleic Acid Binding > SNAI2 MaxPab rabbit polyclonal antibody (D01)
SNAI2 MaxPab rabbit polyclonal antibody (D01) 
- Katalog # : H00006591-D01
- Visit Frequency :
- Größe
- Preis
- In Stock
- Verfügbarkeit
- Cart
- 100 uL
- EUR € 289
- order now, ship next day
-
-
- Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
- Fragen Sie uns
- Zahlungsinformationen
Kreditkarte :
oder Bestellnummer
Email : sales@abnova.com
Phone : +49-6221-825877
Fax : +49-2381-9994411- Produkte werden direkt an den Kunden versandt.
- Specification
- Product Description:
- Rabbit polyclonal antibody raised against a full-length human SNAI2 protein.
- Immunogen:
- SNAI2 (NP_003059.1, 1 a.a. ~ 268 a.a) full-length human protein.
- Sequence:
- MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH
- Host:
- Rabbit
- Reactivity:
- Human
- Quality Control Testing:
- Antibody reactive against mammalian transfected lysate.
- Storage Buffer:
- No additive
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Applications
- Immunoprecipitation
- Immunoprecipitation of SNAI2 transfected lysate using anti-SNAI2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SNAI2 purified MaxPab mouse polyclonal antibody (B01P) (H00006591-B01P).
- Protocol Download
- Entrez GeneID:
- 6591
- GeneBank Accession#:
- NM_003068.3
- Protein Accession#:
- NP_003059.1
- Gene Name:
- SNAI2
- Gene Alias:
- MGC10182,SLUG,SLUGH1,WS2D
- Gene Description:
- snail homolog 2 (Drosophila)
- Gene Ontology:
- Hyperlink
- Gene Summary:
- This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. [provided by RefSeq
- Other Designations:
- OTTHUMP00000195093,neural crest transcription factor SLUG,slug (chicken homolog), zinc finger protein,slug homolog, zinc finger protein,snail 2
- Gene Pathway
- Related Disease
