Produkt-Browser
Click this icon to add products to compare list. Select up to 10 products.
PRKG1 purified MaxPab rabbit polyclonal antibody (D01P) 
- Katalog # : H00005592-D01P
- Visit Frequency :
- Größe
- Preis
- In Stock
- Verfügbarkeit
- Cart
- 100 ug
-
EUR € 289
- order now, ship next day
-
-
- Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
- Fragen Sie uns
- Zahlungsinformationen
Kreditkarte : 
oder Bestellnummer
Email : sales@abnova.com
Phone : +49-6221-825877
Fax : +49-2381-9994411- Produkte werden direkt an den Kunden versandt.
- Product Description:
- Rabbit polyclonal antibody raised against a full-length human PRKG1 protein.
- Immunogen:
- PRKG1 (AAH62688.1, 1 a.a. ~ 312 a.a) full-length human protein.
- Sequence:
- MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQG
- Quality Control Testing:
- Antibody reactive against mammalian transfected lysate.
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Western Blot (Cell lysate)
- PRKG1 MaxPab rabbit polyclonal antibody. Western Blot analysis of PRKG1 expression in IMR-32.
-
Protocol Download
- Western Blot (Transfected lysate)
- Western Blot analysis of PRKG1 expression in transfected 293T cell line (H00005592-T02) by PRKG1 MaxPab polyclonal antibody.
Lane 1: PRKG1 transfected lysate(35.50 KDa).
Lane 2: Non-transfected lysate.
-
Protocol Download
- Western Blot (Transfected lysate)
- enlarge
- Gene Alias:
- CGKI,DKFZp686K042,FLJ36117,MGC71944,PGK,PKG,PRKG1B,PRKGR1B,cGKI-BETA,cGKI-alpha
- Gene Description:
- protein kinase, cGMP-dependent, type I
- Other Designations:
- OTTHUMP00000019619,OTTHUMP00000061216,protein kinase, cGMP-dependent, regulatory, type I, beta
Download
