Produkt-Browser
NBN monoclonal antibody (M02), clone 2C7
Katalog # : H00004683-M02
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
100 ug
EUR € 299
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Mouse monoclonal antibody raised against a partial recombinant NBN.
Immunogen: NBN (NP_002476, 645 a.a. ~ 754 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence: DDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Quality Control Testing: Antibody Reactive Against Recombinant Protein.
Storage Buffer: In 1x PBS, pH 7.2
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Sandwich ELISA (Recombinant protein) Detection limit for recombinant GST tagged NBN is 0.3 ng/ml as a capture antibody.
Protocol Download
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
enlarge
Gene Alias: AT-V1,AT-V2,ATV,FLJ10155,MGC87362,NBS,NBS1,P95
Gene Summary: Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation. [provided by RefSeq
Other Designations: Nijmegen breakage syndrome 1 (nibrin),cell cycle regulatory protein p95,p95 protein of the MRE11/RAD50 complex
Acute Disease Adenocarcinoma Astrocytoma Ataxia telangiectasia Brain Neoplasms Breast cancer Breast Neoplasms Carcinoma, Basal Cell Carcinoma, Ductal Carcinoma, Ductal, Breast Carcinoma, Non-Small-Cell Lung Carcinoma, Transitional Cell Central Nervous System Neoplasms Chromosomal Instability Chromosome Aberrations Chromosome Breakage Chromosome Deletion Cleft Lip Cleft Palate
Colorectal Neoplasms Disease Progression DNA Damage DNA Repair-Deficiency Disorders Esophageal Neoplasms Gastrointestinal Neoplasms Genetic Predisposition to Disease Genital Neoplasms, Female Glioblastoma Glioma Hematologic Diseases Hematologic Neoplasms Hodgkin Disease Kidney Failure, Chronic Laryngeal Neoplasms Leukemia Leukemia, Myeloid Lung Neoplasms Lymphoma Lymphoma, Follicular Lymphoma, Large B-Cell, Diffuse Lymphoma, Non-Hodgkin Lymphoproliferative Disorders Malignant melanoma Medulloblastoma Melanoma Meningeal Neoplasms Meningioma Mouth Neoplasms Multiple Sclerosis Neoplasms Neoplasms, Glandular and Epithelial Neoplasms, Multiple Primary Neoplasms, Second Primary Neuroma, Acoustic Nijmegen Breakage Syndrome Obesity Occupational Diseases Ovarian cancer Ovarian Failure, Premature Ovarian Neoplasms Pancreatic Neoplasms Parkinson Disease Parkinson disease Polycystic Ovary Syndrome Precancerous Conditions Prostate cancer Prostatic Neoplasms Puberty, Delayed Puberty, Precocious Pulmonary Disease, Chronic Obstructive Skin Neoplasms Stomach Neoplasms Syndrome Thrombophilia Thyroid Neoplasms Tobacco Use Disorder Urinary Bladder Neoplasms Uterine Cervical Neoplasms Waldenstrom Macroglobulinemia Werner syndrome
Click this icon to add products to compare list. Select up to 10 products.
Download
