Produkt-Browser

  • Related Product Showcase
  • By Research Area
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

MYB polyclonal antibody (A01)   

  • Katalog # : H00004602-A01
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 50 uL
  • EUR € 195
  • Stock Image
  • order now, ship next day
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MYB.
  • Immunogen:
  • MYB (AAH64955, 541 a.a. ~ 640 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • FCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004602-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • MYB polyclonal antibody (A01), Lot # 050727JC01 Western Blot analysis of MYB expression in HepG2 ( Cat # L019V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4602
  • Gene Name:
  • MYB
  • Gene Alias:
  • Cmyb,c-myb,c-myb_CDS,efg
  • Gene Description:
  • v-myb myeloblastosis viral oncogene homolog (avian)
  • Gene Summary:
  • This gene encodes a transcription factor that is a member of the MYB family of transcription factor genes. The protein contains three domains, an N-terminal DNA-binding domain, a central transcriptional activation domain and a C-terminal domain involved in transcriptional repression. This protein plays an essential role in the regulation of hematopoiesis and may play a role in tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • Avian myeloblastosis viral (v-myb) oncogene homolog,OTTHUMP00000017258,c-myb protein (140 AA),c-myb10A_CDS,c-myb13A_CDS,c-myb14A_CDS,c-myb8B_CDS,v-myb avian myeloblastosis viral oncogene homolog,v-myb myeloblastosis viral oncogene homolog
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!