Produkt-Browser
SMAD3 monoclonal antibody (M02), clone 7F3
Katalog # : H00004088-M02
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
100 ug
EUR € 299
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Mouse monoclonal antibody raised against a partial recombinant SMAD3.
Immunogen: SMAD3 (NP_005893, 120 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence: VCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDL
Quality Control Testing: Antibody Reactive Against Recombinant Protein.
Storage Buffer: In 1x PBS, pH 7.2
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Western Blot (Tissue lysate) SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in human colon.
Protocol Download
Western Blot (Cell lysate) SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in HeLa.
Protocol Download
Western Blot (Cell lysate) SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in PC-12 ( Cat # L012V1 ).
Protocol Download
Western Blot (Cell lysate) SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in 293 ( Cat # L026V1 ).
Protocol Download
Western Blot (Cell lysate) SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in Jurkat ( Cat # L017V1 ).
Protocol Download
Western Blot (Transfected lysate) Western Blot analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody (M02), clone 7F3.
Protocol Download
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SMAD3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Protocol Download
Sandwich ELISA (Recombinant protein) Detection limit for recombinant GST tagged SMAD3 is approximately 0.1ng/ml as a capture antibody.
Protocol Download
In situ Proximity Ligation Assay (Cell)Proximity Ligation Analysis of protein-protein interactions between MAPK8 and SMAD3. HeLa cells were stained with anti-MAPK8 rabbit purified polyclonal 1:1200 and anti-SMAD3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot (Tissue lysate)
enlarge
Western Blot (Transfected lysate)
enlarge
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
enlarge
Sandwich ELISA (Recombinant protein)
enlarge
In situ Proximity Ligation Assay (Cell)enlarge
Gene Alias: DKFZp586N0721,DKFZp686J10186,HSPC193,HsT17436,JV15-2,MADH3,MGC60396
Gene Description: SMAD family member 3
Gene Summary: The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq
Other Designations: MAD, mothers against decapentaplegic homolog 3,SMA- and MAD-related protein 3,SMAD, mothers against DPP homolog 3,mad homolog JV15-2,mad protein homolog,mothers against decapentaplegic homolog 3
Alzheimer Disease Alzheimer disease Anemia, Sickle Cell Anemia, sickle cell Asthma Bacteremia Breast cancer Breast Neoplasms Cleft Lip Cleft Palate Coronary Artery Disease Crohn Disease Diabetes Mellitus, Type 1 Diabetes Mellitus, Type 2 Diabetic Nephropathies Genetic Predisposition to Disease Graft vs Host Disease Head and Neck Neoplasms Hypersensitivity
Hypertension, Pulmonary Keloid Kidney Failure, Chronic Liver Cirrhosis Neoplasm Recurrence, Local Neoplasms, Glandular and Epithelial Neoplasms, Second Primary Obesity Occupational Diseases Osteoarthritis, Hip Osteoarthritis, Knee Osteoporosis Ovarian cancer Ovarian Failure, Premature Ovarian Neoplasms Pancreatic cancer Pancreatic Neoplasms Polycystic Ovary Syndrome Prostate cancer Prostatic Neoplasms Puberty, Delayed Puberty, Precocious Pulmonary Disease, Chronic Obstructive Thrombophilia Tobacco Use Disorder
Click this icon to add products to compare list. Select up to 10 products.
Download
enlarge this image
