Produkt-Browser

  • Related Product Showcase
  • By Research Area
  • By Pathway
  • By Disease
  • By Biomarker
  • By Application
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

IL8 monoclonal antibody (M16), clone 1B4   

  • Katalog # : H00003576-M16
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 100 ug
  • EUR € 299
  • Stock Image
  • order now, ship next day
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant IL8.
  • Immunogen:
  • IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003576-M16
    Western Blot detection against Immunogen (31.69 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • IL8 monoclonal antibody, clone 4G11 ( Cat # H00003576-M16 ) . Western Blot detection against a 8.9 KDa biologically active recombinant human IL-8 ( endothelial-derived ).
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of IL8 transfected lysate using anti-IL8 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with IL8 MaxPab rabbit polyclonal antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3576
  • Gene Name:
  • IL8
  • Gene Alias:
  • CXCL8,GCP-1,GCP1,LECT,LUCT,LYNAP,MDNCF,MONAP,NAF,NAP-1,NAP1
  • Gene Description:
  • interleukin 8
  • Gene Summary:
  • The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. [provided by RefSeq
  • Other Designations:
  • T cell chemotactic factor,beta-thromboglobulin-like protein,chemokine (C-X-C motif) ligand 8,emoctakin,granulocyte chemotactic protein 1,lymphocyte-derived neutrophil-activating factor,monocyte-derived neutrophil chemotactic factor,neutrophil-activating p
  • Related Disease
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!