Produkt-Browser
Click this icon to add products to compare list. Select up to 10 products.
IFNA2 monoclonal antibody (M34), clone 1A11
- Katalog # : H00003440-M34
- Visit Frequency :

- Größe
- Preis
- In Stock
- Verfügbarkeit
- Cart
- 100 ug
-
EUR € 299

- order now, ship next day
-
-
- Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
- Fragen Sie uns
- Zahlungsinformationen
Kreditkarte :

oder Bestellnummer
Email : sales@abnova.com
Phone : +49-6221-825877
Fax : +49-2381-9994411
- Produkte werden direkt an den Kunden versandt.
- Product Description:
- Mouse monoclonal antibody raised against a partial recombinant IFNA2.
- Immunogen:
- IFNA2 (NP_000596, 24 a.a. ~ 188 a.a) partial recombinant protein.
- Sequence:
- MDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.

Western Blot detection against Immunogen (19.2 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Western Blot (Transfected lysate)

- Western Blot analysis of IFNA2 expression in transfected 293T cell line by IFNA2 monoclonal antibody (M34), clone 1A11.
Lane 1: IFNA2 transfected lysate(21.6 KDa).
Lane 2: Non-transfected lysate.
-
Protocol Download
- Western Blot (Transfected lysate)

- enlarge
- Western Blot (Recombinant protein)
- Gene Alias:
- IFNA,INFA2,MGC125764,MGC125765
- Gene Description:
- interferon, alpha 2
- Other Designations:
- OTTHUMP00000021143,alpha-2a interferon,interferon alpha 2b,interferon alpha A