Produkt-Browser
Click this icon to add products to compare list. Select up to 10 products.
HLX1 (Human) Recombinant Protein (Q01)
- Katalog # : H00003142-Q01
- Visit Frequency :
- Größe
- Preis
- In Stock
- Verfügbarkeit
- Cart
- 10 ug
-
EUR € 279
- order now, ship in 5 days
-
- 25 ug
-
EUR € 425
- order now, ship in 5 days
-
-
- Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
- Fragen Sie uns
- Zahlungsinformationen
Kreditkarte : 
oder Bestellnummer
Email : sales@abnova.com
Phone : +49-6221-825877
Fax : +49-2381-9994411- Produkte werden direkt an den Kunden versandt.
- Product Description:
- Human HLX1 partial ORF ( NP_068777, 176 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal.
- Sequence:
- FGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWS
- Theoretical MW (kDa):
- 37.18
- Purification:
- Glutathione Sepharose 4 Fast Flow
- Quality Control Testing:
- 12.5% SDS-PAGE Stained with Coomassie Blue.
- Storage Buffer:
- 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
- Storage Instruction:
- Store at -80°C. Aliquot to avoid repeated freezing and thawing.
- Note:
- Best use within three months from the date of receipt of this protein.
-
- Enzyme-linked Immunoabsorbent Assay
-
- Western Blot (Recombinant protein)
-
- Enzyme-linked Immunoabsorbent Assay
- Western Blot (Recombinant protein)
- Gene Description:
- H2.0-like homeobox
- Other Designations:
- H2.0-like homeo box 1,H2.0-like homeo box-1,H2.0-like homeobox 1,OTTHUMP00000035459,homeobox
Download
