Produkt-Browser
CFH purified MaxPab rabbit polyclonal antibody (D01P)
Katalog # : H00003075-D01P
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
100 ug
EUR € 289
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Rabbit polyclonal antibody raised against a full-length human CFH protein.
Immunogen: CFH (NP_001014975.1, 1 a.a. ~ 449 a.a) full-length human protein.
Sequence: MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL
Quality Control Testing: Antibody reactive against mammalian transfected lysate.
Storage Buffer: In 1x PBS, pH 7.2
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Western Blot (Tissue lysate) CFH MaxPab rabbit polyclonal antibody. Western Blot analysis of CFH expression in human kidney.
Protocol Download
Western Blot (Transfected lysate) Western Blot analysis of CFH expression in transfected 293T cell line (H00003075-T02 ) by CFH MaxPab polyclonal antibody.
Protocol Download
Western Blot (Tissue lysate)
enlarge
Western Blot (Transfected lysate)
enlarge
Gene Alias: ARMD4,ARMS1,CFHL3,FH,FHL1,HF,HF1,HF2,HUS,MGC88246
Gene Description: complement factor H
Gene Summary: This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short concensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations: H factor 1 (complement),H factor 2 (complement),OTTHUMP00000033598,age-related maculopathy susceptibility 1,beta-1-H-globulin,beta-1H,complement factor H, isoform b,factor H,factor H-like 1
Alport syndrome Alzheimer Disease Alzheimer disease Arthritis, Rheumatoid Asthma Ataxia Telangiectasia Ataxia telangiectasia Atherosclerosis Atherosclerosis Atrophy Blindness Brain Ischemia Calcinosis Cardiovascular Diseases Carotid Artery Diseases Cerebrovascular Accident Chlamydia Infections Chlamydophila Infections Choroid Diseases
Choroidal Neovascularization Choroiditis Coronary Artery Disease Coronary Disease Crohn's disease Diabetes Complications Diabetes Mellitus, Type 1 Diabetes Mellitus, Type 2 Diabetic Nephropathies Diabetic Retinopathy Disease Progression Disease Susceptibility Diseases in Twins Ductus Arteriosus, Patent Edema Functional Laterality Genetic Predisposition to Disease Geographic Atrophy Glomerulonephritis, IGA Glomerulonephritis, Membranoproliferative Hemolytic-Uremic Syndrome Hyperlipoproteinemia Type II Hypertension Immune System Diseases Infant, Premature, Diseases Inflammation Inflammatory Bowel Diseases Kidney Failure, Chronic Lung Neoplasms Lymphoma, Non-Hodgkin Macular Degeneration Meningococcal Infections Myocardial Infarction Nephritis, Hereditary Obesity Obesity Peripheral Vascular Diseases Pre-Eclampsia Prostate cancer Prostatic Neoplasms Pseudoxanthoma Elasticum Pulmonary Disease, Chronic Obstructive Purpura, Thrombotic Thrombocytopenic Recurrence Retinal Degeneration Retinal Diseases Retinal Drusen Retinal Neovascularization Retinopathy of Prematurity Spinocerebellar ataxia Staphylococcal Infections Stroke Systemic Inflammatory Response Syndrome Taste Urinary Bladder Neoplasms Venous Thrombosis Werner syndrome Wet Macular Degeneration
Click this icon to add products to compare list. Select up to 10 products.
Download
