Produkt-Browser
FXN (Human) Recombinant Protein (Q01)
Katalog # : H00002395-Q01
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
10 ug
EUR € 279
order now, ship in 5 days
25 ug
EUR € 425
order now, ship in 5 days
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Human FXN partial ORF (AAH48097.1, 91 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence: DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL
Theoretical MW (kDa): 37.84
Purification: Glutathione Sepharose 4 Fast Flow
Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note: Best use within three months from the date of receipt of this protein.
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Gene Alias: CyaY,FA,FARR,FRDA,MGC57199,X25
Gene Description: frataxin
Gene Summary: This nuclear gene encodes a mitochondrial protein which belongs to FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations: OTTHUMP00000021428
Click this icon to add products to compare list. Select up to 10 products.
Download
