Produkt-Browser
Click this icon to add products to compare list. Select up to 10 products.
FOS (Human) Recombinant Protein (P01)
Katalog # : H00002353-P01
Visit Frequency :
Größe
Preis
In Stock
Verfügbarkeit
Cart
10 ug
EUR € 279
order now, ship next day
25 ug
EUR € 425
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Kreditkarte : oder Bestellnummer
Email : sales@abnova.com Phone : +49-6221-825877 Fax : +49-2381-9994411
Produkte werden direkt an den Kunden versandt.
Product Description:
Human FOS full-length ORF ( AAH04490, 1 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence:
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Theoretical MW (kDa):
67.54
Purification:
Glutathione Sepharose 4 Fast Flow
Quality Control Testing:
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction:
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note:
Best use within three months from the date of receipt of this protein.
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Gene Description:
v-fos FBJ murine osteosarcoma viral oncogene homolog
Gene Summary:
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. [provided by RefSeq
Other Designations:
FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS),activator protein 1,cellular oncogene c-fos