Produkt-Browser
Click this icon to add products to compare list. Select up to 10 products.
EXTL2 purified MaxPab mouse polyclonal antibody (B01P) 
- Katalog # : H00002135-B01P
- Visit Frequency :
- Größe
- Preis
- In Stock
- Verfügbarkeit
- Cart
- 50 ug
-
EUR € 299
- order now, ship next day
-
-
- Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
- Fragen Sie uns
- Zahlungsinformationen
Kreditkarte : 
oder Bestellnummer
Email : sales@abnova.com
Phone : +49-6221-825877
Fax : +49-2381-9994411- Produkte werden direkt an den Kunden versandt.
- Product Description:
- Mouse polyclonal antibody raised against a full-length human EXTL2 protein.
- Immunogen:
- EXTL2 (AAH36015, 39 a.a. ~ 330 a.a) full-length human protein.
- Sequence:
- LLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNITISQFGFPYANYKRKI
- Quality Control Testing:
- Antibody reactive against mammalian transfected lysate.
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Western Blot (Transfected lysate)
- Western Blot analysis of EXTL2 expression in transfected 293T cell line (H00002135-T01) by EXTL2 MaxPab polyclonal antibody.
Lane 1: EXTL2 transfected lysate(36.41 KDa).
Lane 2: Non-transfected lysate.
-
Protocol Download
- Western Blot (Transfected lysate)
- enlarge
- Gene Description:
- exostoses (multiple)-like 2
- Other Designations:
- OTTHUMP00000013586,OTTHUMP00000013587,alpha-1,4-N-acteylhexosaminyltransferase,exostosin-like 2,multiple exostoses-like 2
Download
