Produkt-Browser
EPO monoclonal antibody (M02), clone 1B12
Katalog # : H00002056-M02
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
100 ug
EUR € 299
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Mouse monoclonal antibody raised against a full-length recombinant EPO.
Immunogen: EPO (NP_000790.2, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence: MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Quality Control Testing: Antibody Reactive Against Recombinant Protein.
Storage Buffer: In 1x PBS, pH 7.2
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Western Blot (Transfected lysate) Western Blot analysis of EPO expression in transfected 293T cell line by EPO monoclonal antibody (M02), clone 1B12.
Protocol Download
Sandwich ELISA (Recombinant protein) Detection limit for recombinant GST tagged EPO is 0.03 ng/ml as a capture antibody.
Protocol Download
Western Blot (Transfected lysate)
enlarge
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
enlarge
Gene Description: erythropoietin
Gene Summary: This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. [provided by RefSeq
Other Designations: epoetin
Amyotrophic Lateral Sclerosis Amyotrophic lateral sclerosis Cardiovascular Diseases Dermatitis, Atopic Diabetes Mellitus, Type 1 Diabetes Mellitus, Type 2 Diabetic Nephropathies Diabetic Retinopathy Edema Genetic Predisposition to Disease Leukemia, Myelogenous, Chronic, BCR-ABL Positive Leukemia, Myeloid, Acute Myelodysplastic Syndromes Retinopathy of Prematurity Rhinitis, Allergic, Perennial Rhinitis, Allergic, Seasonal
Click this icon to add products to compare list. Select up to 10 products.
