Produkt-Browser
EFNA3 purified MaxPab rabbit polyclonal antibody (D01P)
Katalog # : H00001944-D01P
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
100 ug
EUR € 289
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Rabbit polyclonal antibody raised against a full-length human EFNA3 protein.
Immunogen: EFNA3 (NP_004943.1, 1 a.a. ~ 238 a.a) full-length human protein.
Sequence: MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Quality Control Testing: Antibody reactive against mammalian transfected lysate.
Storage Buffer: In 1x PBS, pH 7.2
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Western Blot (Cell lysate) EFNA3 MaxPab rabbit polyclonal antibody. Western Blot analysis of EFNA3 expression in Jurkat.
Protocol Download
Western Blot (Transfected lysate) Western Blot analysis of EFNA3 expression in transfected 293T cell line (H00001944-T01 ) by EFNA3 MaxPab polyclonal antibody.
Protocol Download
Western Blot (Transfected lysate)
enlarge
Gene Alias: EFL2,EPLG3,Ehk1-L,LERK3
Gene Description: ephrin-A3
Gene Summary: This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. [provided by RefSeq
Other Designations: OTTHUMP00000033243,eph-related receptor tyrosine kinase ligand 3,ephrin A3,ligand of eph-related kinase 3
Click this icon to add products to compare list. Select up to 10 products.
Download
