Produkt-Browser
EDG1 monoclonal antibody (M03), clone 1F11
Katalog # : H00001901-M03
Visit Frequency :
Größe Preis In Stock Verfügbarkeit Cart
100 ug
EUR € 299
order now, ship next day
Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
Fragen Sie uns
Zahlungsinformationen Produkte werden direkt an den Kunden versandt.
Product Description: Mouse monoclonal antibody raised against a partial recombinant EDG1.
Immunogen: EDG1 (AAH18650, 1 a.a. ~ 47 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence: MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKL
Quality Control Testing: Antibody Reactive Against Recombinant Protein.
Storage Buffer: In 1x PBS, pH 7.2
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Western Blot (Transfected lysate) Western Blot analysis of EDG1 expression in transfected 293T cell line by EDG1 monoclonal antibody (M03), clone 1F11.
Protocol Download
Sandwich ELISA (Recombinant protein) Detection limit for recombinant GST tagged EDG1 is approximately 0.3ng/ml as a capture antibody.
Protocol Download
Western Blot (Transfected lysate)
enlarge
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
enlarge
Gene Alias: CHEDG1,D1S3362,ECGF1,EDG-1,EDG1,FLJ58121,S1P1
Gene Description: sphingosine-1-phosphate receptor 1
Gene Summary: The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq
Other Designations: G protein-coupled sphingolipid receptor,OTTHUMP00000012525,endothelial differentiation, sphingolipid G-protein-coupled receptor, 1,sphingosine 1-phosphate receptor EDG1
Click this icon to add products to compare list. Select up to 10 products.
Download
