Produkt-Browser

Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

DSCR1 (Human) Recombinant Protein (Q01)   

  • Katalog # : H00001827-Q01
  • Visit Frequency :
  • Land (Wohnsitz) :
  • Größe
  • Preis
  • In Stock
  • Verfügbarkeit
  • Cart
  • 10 ug
  • EUR € 279
  • Stock Image
  • order now, ship in 5 days
  • Add to Cart
  • 25 ug
  • EUR € 425
  • Stock Image
  • order now, ship in 5 days
  • Add to Cart
    1. Der Preis gilt nur für die Germany. Bitte wählen Sie ein Land aus.
  • Fragen Sie uns
  • Zahlungsinformationen

    Kreditkarte :
    oder Bestellnummer

  • Email : sales@abnova.com
    Phone : +49-6221-825877
    Fax : +49-2381-9994411
  • Produkte werden direkt an den Kunden versandt.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Human DSCR1 partial ORF ( AAH02864, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPN
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001827-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1827
  • Gene Name:
  • RCAN1
  • Gene Alias:
  • ADAPT78,CSP1,DSC1,DSCR1,MCIP1,RCN1
  • Gene Description:
  • regulator of calcineurin 1
  • Gene Summary:
  • The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Down syndrome candidate region 1,Down syndrome critical region gene 1,calcipressin 1,calcium and oxidant-inducible mRNA,modulatory calcineurin-interacting protein 1,myocyte-enriched calcineurin-interacting protein 1,near DSCR proline-rich protein
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!